General Information

  • ID:  hor005254
  • Uniprot ID:  P40765
  • Protein name:  Xenin
  • Gene name:  COPA
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  NA
  • Source:  Animal
  • Expression:  Released into the circulation after a meal.|Gastric, duodenal and jejunal mucosa. Circulates in the blood. Seems to be confined to specific endocrine cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  MLTKFETKSARVKGLSFHPKRPWIL
  • Length:  25(1-25)
  • Propeptide:  MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P40765-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005254_AF2.pdbhor005254_ESM.pdb

Physical Information

Mass: 339985 Formula: C139H224N38O32S
Absent amino acids: CDNQY Common amino acids: K
pI: 11.82 Basic residues: 7
Polar residues: 5 Hydrophobic residues: 9
Hydrophobicity: -37.6 Boman Index: -3834
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 3119.6 Extinction Coefficient cystines: 5500
Absorbance 280nm: 229.17

Literature

  • PubMed ID:  8899805
  • Title:  Identification of proxenin as a precursor of the peptide xenin with sequence homology to yeast and mammalian coat protein alpha.
  • PubMed ID:  2235681
  • Title:   Isolation and sequence of canine xenopsin and an extended fragment from its precursor.